Home Blog Pagina 591

Games with Gold: i regali di Dicembre per Xbox

0

Games with GoldCon Games with Gold il dicembre di Xbox sarà ancora più ricco di regali, ecco tutti i titoli in promozione:
· Worms Battlegrounds, disponibile dall’1 al 31 dicembre per Xbox One: l’ultimo capitolo della serie di Worms è più grande, più divertente e consente di guidare la propria armata utilizzando più armi e abilità che mai;
· The Raven: Legacy of a Master Thief, disponibile dall’1 al 15 dicembre per Xbox 360: ambientato nell’Europa degli anni Sessanta, il protagonista visiterà location incredibili e vivrà ambienti realizzati con incredibile maestria;
· SSX, disponibile dal 16 al 31 dicembre su Xbox 360: rilettura moderna di uno dei franchise arcade più apprezzati di sempre, darà ai giocatori la possibilità di vivere momenti di divertimento e ricchi di adrenalina su montagne storiche di tutto il mondo.

Call of Duty Advanced Warfare: Exo Zombie nel nuovo Trailer

0

Activision e Sledgehammer Games hanno diffuso un nuovo trailer dell’attesissimo Call of Duty Advanced Warfare in cuo possiamo vedere il debutto degli Exo Zombies:

Call-of-Duty-Advanced-Warfare-E3-3Call of Duty: Advanced Warfare è un videogioco sparatutto in prima persona, sviluppato da Sledgehammer Games e pubblicato da Activision. È l’undicesimo capitolo della saga Call of duty ed il primo sviluppato interamente da Sledgehammer Games . Il gioco è stato pubblicato per Microsoft Windows, PlayStation 3, PlayStation 4, Xbox 360 e Xbox One il 4 novembre 2014. È il primo gioco della serie facente parte del ciclo di sviluppo triennale.

Advanced Warfare, come gli altri Call of Duty, è presentato come uno sparatutto in prima persona. Tuttavia, il gioco presenta diversi cambiamenti, Advanced Warfare non utilizza un HUD tradizionale; tutte le informazioni sono trasmesse al videogiocatore tramite proiezioni olografiche dall’arma equipaggiata. Il livello delle armi in generale rimane invariato, se non per una nuova meccanica per la quale certe pistole potranno ricaricare lentamente, permettendo al giocatore di prendere copertura e rimanere lì per un certo periodo di tempo per ottenere munizioni per l’arma. Il giocatore può anche cambiare diversi tipi di granate mentre ne usa una tramite i tasti tradizionali.

LittleBigPlanet 3: nuovo video

0

Cresce l’attesa per l’arrivo di LittleBigPlanet 3 sulle capacità dell’editor del nuovo titolo targato Sumo Digital.

littlebig planet-3LittleBigPlanet (letteralmente PiccoloGrandePianeta, chiamato Craftworld durante lo stadio di sviluppo) è un videogioco a piattaforme sviluppato per PlayStation 3. È stato annunciato la prima volta il 7 marzo 2007, da Phil Harrison al “2007 Game Developers Conference” a San Francisco. È stato sviluppato da Media Molecule, una società britannica fondata in parte dal creatore di Rag Doll Kung Fu, di Mark Healey.

Pubblicato da Sony Computer Entertainment Europe ed inizialmente previsto per il 22 ottobre 2008, ha subìto un leggero rinvio a causa della scoperta di una citazione del Corano contenuta in un brano su licenza (esattamente nel secondo capitolo, “la savana”). Il gioco è stato lanciato con la frase “PLAY, CREATE, SHARE”. Il gioco si differenzia da molti altri nella possibilità di creare un livello a proprio piacimento (dalla modalità Avventura, alla modalità Horror, Automobilistica, sparatutto e fantasy) con oggetti raccolti durante la modalità storia.

Football Manager 2015: A lezione da Piero Ausilio[video]

0

Piero Ausilio, DS dell’Inter ci insegna come diventare dei grandi Football Manager 2015. Oggi la prima lezione, continuate a seguirci per le prossime.

Football Manager 2015Football Manager 2015, l’ultimo capitolo della pluripremiata serie vincitrice di numerosi premi e che ha stabilito sensazionali record di vendite in tutto il mondo, è disponibile dal 7 novembre per PC, Mac e Linux.
Football Manager è il gioco di gestione calcistica più realistico, dettagliato e coinvolgente in circolazione, che mette il giocatore alla guida di quasi ogni squadra esistente in oltre 50 paesi del mondo, compresi i maggiori campionati europei.
Potrai determinare quale sarà il tuo stile manageriale come mai prima d’ora, specializzandoti nell’allenare, nel fare l’osservatore, nel diventare un guru del settore giovanile, così come potrai scegliere di specializzarti nella gestione delle risorse umane o un po’ di tutto questo.
In questa ultima versione, la profondità di gioco e il realismo del motore 3D sono migliorati grazie a più di 2.000 nuove animazioni, nuovi effetti luce, miglioramenti ai modelli dei giocatori e alla fisica del pallone.
Una nuova intelligenza artificiale, istruzioni individuali, discussioni a bordo campo e altre migliorie danno maggior realismo alla simulazione di gioco.

Assassin’s Creed Unity: oltre 300 correzioni nella Patch 3 disponibile da oggi

0

assassins-creed-unity-arno

Una notizia che farà brillare gli occhi a tutti gli utenti di Assassin’s Creed Unity: da oggi Ubisoft rilascerà gradualmente la Patch 3 per Ps4 e Xbox One, con oltre 300 correzioni fondamentali. Chi sta giocando il titolo in questi giorni sa bene quanti problemi si incontrino durante le ore di gameplay, da oggi – si spera – dovrebbe essere tutto sistemato, compresi i crash random, i bugs delle animazioni e i glitches online.

La patch va a migliorare anche il frame rate, tanto bersagliato nelle ultime settimane. Ma non è tutto, Ubisoft ha annunciato di essere al lavoro già sulla patch seguente interamente dedicata al frame rate. Ma ecco il change log ufficiale di questa Patch 3:

Stability & Performance

  • Fixed numerous random crashes for both on Campaign and Co-op
    • (90+ various low reproduced crashes)
  • Fixed specific framerate drops
    • Improved general Framerate on PS4 by lowering the priority of the online services thread
    • Fixed FPS drops while Arno climbs on the RHP building of Palais de Justice
    • Fixed FPS drops when in climbing and pressing the Left Stick towards somewhere that is not climbable in certain areas
    • Fixed FPS drops in Sainte Chapelle

Gameplay (navigation, fight, stealth)

  • Fixed navigation issues where the player gets stuck. Specific fixed instances of this are listed below:
    • [Invalides] Arno will get stuck and fall under the map when he uses free run down button on the stone handrail type
    • [Mission: Occupied Paris] Arno can fall through a certain zeppelin and remain stuck after performing a jumping action from the top of the zeppelin.
    • [Palais De Justice] Arno can remain stuck when climbing part of the roof on Palais De Justice during free roam
    • [Saint-Louis] Arno remains stuck while trying to pass over a table
    • [Cité]Arno can remain stuck while trying to collect nomad point from Notre-Dame
    • [Porte-Saint-Denis]Arno remains stuck after falling between 2 props
    • [Temple] Arno can remain stuck inside a building corner at the Temple by using controlled descent
    • [Mission :POLITICAL PERSECUTION] Arno remains stuck near a wall located on the rooftop
    • [Mission: OCCUPIED PARIS] Arno remains stuck in a certain pile of wooden crates after performing a climbing action
    • [Cité] Arno can remain stuck after performing a slide on a building near Notre Dame
    • [Cité]Arno gets stuck on the chair while trying to climb the building
    • [Les Invalides] Arno remains stuck in the wall while using controlled descend after performing the Invalides RHP
  • Fixed haystack issues where the player can stay stuck in it. Specific fixed instances of this are listed below:
    • [Saint-Louis] Arno is stuck in the haystack near the bridge near the Assassin HQ.
    • [Mission: HEADS WILL ROLL] Arno remains stuck if they hide in the haystack that is located in the area with “Kill the Templars 0/3” objective.
    • [Les Invalides] Arno gets stuck and is unable to exit the indicated haystack cart
    • [Cité] Arno remains stuck in a haystack near the Notre Dame
  • Fixed Cover issues
    • Fixed an issue where Arno could not peek while in cover and standing.
    • Fixed an issue where the incorrect Cover Assassination animation is played when pressing RT+X (Or Square) when an NPC is close enough to perform a Low Profile Assassination.
    • Fixed an issue with right facing cover quick drop animation.
  • Fixed various camera issues
    • Camera will occasionally focus on nothing when performing a High Profile Cover Assassination.
  • Fixed animation issues
    • High Profile stop animation plays when walking then stopping in an indoor area.
    • High Profile start animation repeats when starting to move while in Stealth Navigation in a specific type of building.
    • Arno will not enter incapacitated stance if dying while in customization menu
    • Arno performs a Wall Eject in the wrong direction at the bottom of ladders.
    • Arno doesn’t enter V-Shape properly from Defenestrate onto the V-Shape’s side.
    • Arno will remain in a running animation for several second after jumping from a collision to another
    • Climbing up angled edges is very slow.
    • Arno performs CornerTurns instead of climbing regularly when going to the left on rounded structures.
    • Beam Low Profile Step is too fast over greater distances in between beams.
    • Arno goes past the edge of cover when Peeking up then moving backwards at a certain distance away from the edge of the cover.
    • Arno can play the upper body animation of not having any grenades while climbing up
  • Fixed some Booster issues
    • Activating a booster during a mission and restarting the memory will stop the booster and give it back to the player
    • Inconsistency between the number of boosts selected and the number displayed in the buy widget after redeeming a boost uplay reward.
    • Arno will teleport when descending from Fences and Walls
    • The Stealth Boost counter does not work properly.
    • Climb to Hang corner transition isn’t always smooth.

AI & Crowd

  • Fixed various animation issues
    • [Café theatre] Intendant slides quickly from between two stations
    • NPC was observed walking in the air and, at another point, running in place
  • Fixed various detection issues
    • NPCs can remain stuck in their bomb attack aim behavior which causes all other NPCs to stop attacking
    • If the LOS is lost during a major scold with guard post NPC they will go to the LKP instead of staying in position.
    • [Mission: The Chemical Revolution] Two aggressors inside the house are invulnerable on any of Arno’s actions
    • Guards can be stuck in a detection loop and never attack the player
  • Fixed various crowd stations issues
    • [Ventre de Paris][Hotel de Ville] Crowd NPC can be found spawning inside a prop.
    • [Quartier Latin][Luxembourg] After the user shoots towards some NPC that are sitting on some boxes, one of them can get into the wall
    • [Louvres][Tuileries] Some NPCs on the bridge between Tuilreies and Saint-Thomas-d’Aquin are not scared if Arno draws his sword
    • [Louvre][Feydeau] Missing chair from the NPC Station near a building
    • [Ventre de Paris][Porte-Saint-Denis] The npc’s standing on chairs at the indicated house interior are fleeing into the props when Arno scares them
    • Character model issue in a crowdlife station.
    • When remaining idle in the game for multiple hours, player will see crowd floating in the Air.
    • Horse carts fall through world when moving 115m+ away from them
    • [Louvre – Tuileries][Crowdlife] Some people from the crowd are spawned in the ground
    • Low Rez crowd can be seen when walking in the Street

Matchmaking, Connectivity & Replication

  • Fixed various matchmaking issues
    • The title enters an unresponsive state for both client and host if the client fast travels far away while the coop mission is being
    • Client remains stuck on loading screen if the Host Signs Out from PSN as soon as the client is on the loading screen towards the session
    • Wrong session attached to game party after having received a ghost
    • [Mission: LES ENRAGÉS] The map does not start when a 4P group starts the mission a second time
    • The user is unable to access the COOP or Heist missions from Progress Tracker while in Versailles
    • [Mission: DANTON’S SACRIFICE] After a toy of 4 players, using progress tracker to launch mission leaves all players with Waiting For.
    • Storm failure error 0xB9145EA0 received after accepting invite to a coop mission
    • [Voice Chat] A member of a toy party that is muted by a player can still be heard by that player if a coop mission is started afterwards
    • Client can be not pulled into host’s world after accepting party and game invite
    • Players can be stuck on “waiting for the other players” message after starting a heist following certain steps
    • The user will be unable to start the first toy session if he remains in Progress Tracker until the other players joins his world
    • One of the clients can receive Server error message on the search screen for LB050
    • Sometimes, other friends gamertags appear for the ones invited in toy sessions
    • The client of a TOY session can remain stuck after entering the mission if he Fast Travels while the host starts any mission
    • [Mission : POLITICAL PERSECUTION] After the Host interacted with the last sewer gate, the objective didn’t update until the Host exited the session
    • Clients of a TOY party have the option to Restart Memory right before a private session starts, creating stuck situations
    • The user will remain stuck on loading screen after accepting an invite just before the RIFT tutorial is completed.
    • All 4 players can remain on an infinite “Waiting for other players..” loading screen after the host started THE FOOD CHAIN mission through the Play Co-op Now search
    • User cannot start another rift mission if he accepts a coop invite during a rift transition out cinematic without pressing any button on the AMD.
    • Title crashes when the Client accepts an invite and the Host Fast Travels to Versailles while the client is on the loading screen
    • Clients of a TOY party can remain stuck on loading screen when trying to start a private mission of 2 Players after previously completing a 4 Players mission with a full TOY party.
    • All players can get stuck on a black screen after starting the transition from freeroam to a mission.
    • Accepting an invite towards an empty session can leave the user without in-game sound.
    • [Mission: SMUGGLER’S PARADISE] When starting the Heist in Solo Private from the mission giver, the screen can remain black
    • Toy members can remain on “Waiting for players” after 2 players quit the group and the remaining toy started another mission
    • Accepting an invite to join or rejoin a player in a session can send the user in another session with other players
    • Support ability to start a COOP or Heist mission with the progress tracker if that Mission’s World is not the Player’s current world
  • Fixed various host migration issues
    • Performing a Host Migration while the users are on the AMD screen will split up the TOY
    • The former host of a session receives the “Connection failed” error after being invited back into the mission by the new host
    • Quit group option is not available after a TOY party leader starts a private session while the rest of the party is still on AMD screen
  • Fixed join-in-progress issues
    • When joining a coop from an existing group, the client of that group being from [Le roi est mort] mission, and then leaving the mission, he can no longer move the camera when going back in his single player mission
    • [Mission: LES ENRAGÉS] Impossible to interact with Quest NPC once a Join n progress is done at the start of ACT2
    • A client that joins a private session while in another private session has three loading screens
    • Join in progress Ghost does not spawn while the user is in Versailles
    • The gear rewards from a full completed mission will disappear after the user JIP and returns to free roam
    • One of the clients remains on loading screen and the other remaining players do not have an objective , after joining a toy session and starting mission ANCIENT HISTORY from progress tracker.
    • [Mission: POLITICAL PERSECUTION][Act 1] The objective remained stuck after a JIP occurred during act 1
    • [Mission: WOMEN’S MARCH][Act3] – The last objective will not update if a join in progress is performed as the users interact with the cannons
  • Fixed various replication issues between host and clients
    • [Mission: THE TOURNAMENT][Act 2]The arena reinforcements are not replicated for the clients
    • [Crowd] Sometime the Dead Replica Body will remain in a Stand up position
    • [Mission: WOMEN’S MARCH][Replication]After failing the mission some clients may see Theroigne and her ally walking backwards
    • [Mission: THE FOOD CHAIN] Theroigne is seen moving backwards as the host
    • [Mission: ANCIENT HISTORY ] One of the clients was replicated as far away until they moved when first spawning in the mission
    • [Mission: ROYALS, GUNS AND MONEY] After interacting with a door, the client lost his eagle vision and the door replicated as closed for him and opened for everyone else
    • Player sees his teammate get up before unspawning
    • Simultaneously interacting with locked doors/chests lit by Eagle Vision causes the object to become unresponsive and Eagle Vision to lose its functionality
    • If multiple players revive someone at the same time, he will either stay dead, or be displayed as dead on every screen but his own, or he will not be able to be revived and will be stuck dead.
    • [Mission: MOVING MIRABEAU] The Client and his actions are invisible to the Host after the Client performs a JIP when the Host opens the Crypt Gate.
    • [Mission: THE FOOD CHAIN] One of the NPCs spawns only for one of the Clients causing Theroigne to remain stuck
    • [Mission: HEADS WILL ROLL][ACT 1] The mission objective will disappear for the Host if he interacts with the chest objective in Act 1
    • Enemy AI do not attack after starting [Mission: WOMEN’S MARCH] in 4 player toy session for a second time after completing the mission the first time
    • [Mission: THE TOURNAMENT] Replication and lag issues can be observed between players during combat
    • Replica sees the master in an intermittent animation while the master is aiming the gun and looking around
    • Friend widget displays wrong user after starting a second COOP session
  • Fixed various issues in the My Club menu
    • All members except the user will appear unavailable, even though they are online, as long as there are only 4 members in the club (creator included).
    • Same club objective will appear for all the club challenges when a save is performed

Menus and HUD

  • Fixed various menu issues and pop-up overlap issues
    • “Extra Rewards” does not fit the safe area of the TV on Helix Credits screen.
    • Helix Packs are displayed off screen when viewing the Helix Credits menu in several languages
    • The Uplay window will appear for a very short time if the user beats a ghost’s score in a rift
    • It is possible to access the Gear Loadout while being in combat
    • A Cockade from Tuileries district is marked collected in Vendôme district.
    • Game crashes in the character customization menu after performing certain steps
    • Long weapon “Golden Bec de Corbin” does not become available after redeeming it via uplay points
    • User can access the Character Customization menu if booting the game while offline and selecting to connect from the newsfeed message
    • The background on the progress tracker is missing when the player is in resurrection animation
    • The AMB COOP menu overlaps the Customization menu if the host changes gear near the COOP mission givers
    • [Friend Widget] Waiting for is not correctly place under the health bar.
    • The progression bars on the Assassin Rank widget/helix do not register the progress
    • The price bar for renovating a Social club is not complete
  • Fixed Mission objectives & updates issues
    • The Average Mission/Member count doesn’t display the correct numbers
    • [Mission: THE ESTATES GENERAL] Permanent hint will be displayed above Arno (until reaching the next objective) if the user will descend from the top of the RHP instead of leaping in the hay stack.
    • After completing the game, the Francois-Thomas Germain AFS will pop up after every desync
    • Unspent Sync Points notification pops up too often
  • Fixed issues in customization menu
    • After buying the “Master Sans-Culottes Belt” the user will notice that upgrading costs 31250 creed points instead of 5000
    • Arno’s Original pieces of gear can no longer be equiped if the user equips other gear during SQ03M05
    • A specific weapon reward cannot be equipped and it doesn’t have any image or animation
    • There needs to be a flag to illustrate what is new when you receive a gear or weapon in the menu
  • Fixed some localization inconsistencies in the menus
    • Inconsistencies can be noticed on several languages, regarding the trophy description for “Hydrogen Bonded” and “Fraternité!”
    • Placeholder text is displayed on the map when the user is not signed in with any SEN account.
    • [Boot up sequence] Message is displayed in the wrong language when booting the game in Spanish.
    • [Villa-Arno’s Room] Button incompletely displayed to access the Progress Tracker in certain languages
    • Typo in Wall Eject causes mistranslation
  • Fixed some Credits issues
    • Missing dates of first publication in the LIBTESS section of the credits
    • Several spacing errors are present in the credits

Mission tweaks (campaign, coop & side content)

  • Fixed various low repro walkthrough breaks
    • [Mission: THE BODY IN THE BROTHEL] The 6th Clue location is not displayed
    • [Mission: The Great escapist] Mission will fail if Arno kills the Quartermaster before his specific orange icon appears on minimap
    • [Mission: Let them eat hay] The mission breaks when the user kills some of the targets before the objective updates.
    • [Mission: IMPRISONED] Bellec and his target can remain stuck if the player kills the guard too fast after entering the cell
    • [Mission: Confession] Arno gets stuck when interacting with the priest atop the church
    • [Mission: Training] Roll recovery training can be very hard to complete.
    • [Mission: Extortion contortion] The mission will fail if the user runs away from the area after finding the Extortionist, while the woman’s Follow marker is still present on the map
    • [Mission: The Temple] Arno remains stuck in the walls of the Temple after hitting Germain and trying to climb down to find him in the catacombs
    • [Mission: Les Enragés] Arno remains stuck making a few steps from the spawn point
    • [Mission: STOP THE PRESSES!] Climbing the wall just after interacting with the poster will render Arno stuck
    • [Mission: IMPRISONED] User cannot jump off the prison’s tower and remains stuck on its ledge
    • The main mission progress is lost if the user accepts an invite at the end of a RIFT mission and then selects to Play Next Rift on AMD.
    • [Mission: Ancestral Vengeance] If the player opens the door of the last location while on the nearby barrel, he will get stuck
    • [Mission: DANTON’S SACRIFICE ] Objective does not update in ACT 2 after replaying the mission
    • [Mission: TALL, DARK STRANGERS] Mission doesn’t update with “Kill the Soldier” objective
    • [Mission: WOMEN’S MARCH] The objective “SABOTAGE the cannons” did not update after all the remaining players interacted at the same time with the cannons
    • [Mission: IMPRISONED] User can fall through the textures during “Escape the Bastille” objective when jumping out the first window.
    • [Mission: LES ENRAGÉS] When two assassins interact with a locked door at the same time and both exit the lockpicking interface, one of them will get stuck
  • Fixed various NPC navigation issues
    • [Mission: IMPRISONED] Bellec can remain stuck if the user stays in front and on the same path
    • [Mission: A FISTFUL OF DUELERS] After killing the 4th duelist, the second enemy from that location remains stuck – does not attack.
  • Fixed inconsistencies in some missions
    • [Mission: TALL, DARK STRANGERS] Lenormand’s Clone present on the location where the mission was previously failed
    • [Mission: HIGH SOCIETY] NPCs can be seen before the cinematic, in the courtyard where De La Serre is assassinated
    • [Mission: HEADS WILL ROLL ] Missing shopkeeper NPC from the area where templars targets are spawned
    • [Mission: CONFRONTATION] The cinematic doesn’t trigger if the user does not activate “Eagle Pulse” when reaches Saint Chapelle
    • [Mission: À LA LANTERNE!] The third wave of aggressors does not attack the duchess
    • [Companion] An Ambush mission will randomly finish when reaching the target defend area without having done anything
    • [Mission: WOMEN’S MARCH] After using the Progress Tracker to start LB020 for the second time in a 2 player toy session, the mission starts directly in ACT 3
    • Arno can get an indefinite amount of Creed Points if he headshots incapacitated targets
    • [Mission: THE ASSASSINATION OF JEAN-PAUL MARAT] The player cannot interact with the letter in the Hotel for a few minutes
    • [Mission: MOVING MIRABEAU][Act 2] The assassins have no collision with the hidden door in the catacombs when replaying the mission a second time
    • [Mission: DANTON’S SACRIFICE ]The extremists will not prioritize Dalton’s ally that spawns near the coaches and will behave inappropriate when players are around him
    • [Mission: HEADS WILL ROLL ] Arno lost two assassin ranks after replaying RB030 and quitting the mission
    • [Mission: CATACOMB RAIDER] Mission started with very low light level for the client
    • [Mission: MARIANNE RETURNS HOME] After completing the practice objective, if the user runs (~20m) the NPC is despawned
    • [Mission: The Estates General] After failing to get in the Hotel des Menus Plaisirs, after you are respawned – the crowd life near the carriage is missing – thus the mission cannot be completed on the normal path.
    • The SQ03 /SQ04 trophy is unlocked completing the first mode mission of SQ03M020 / SQ04M020
    • [Mission: THE INFERNAL MACHINE] The objective “Kill the Royalist Leader” is not checked (completed) after the users kill the Royalist Leader.
    • [Mission: IT BELONGS IN A MUSEUM] Player cannot use HP potion inside the Luxembourg Museum.

World & 3D

  • Fixed various collisions and navigation mesh issues

Progression & Difficulty

  • Adjusted various community events rewards

PC-Specific

  • Fixed saves corruptions in some cases
  • Fixed temporal blur for SLI
  • Fixed graphical corruptions in Character Customization menu
  • Fixed crash in Character Customization menu on controller autoswitch
  • Alt+Enter switch window modes correctly
  • NPC on side monitors shows correctly
  • Minor UI improvements

Minecraft incontra Star Wars: da oggi disponibile l’esclusivo DLC

0

2744580-minecraftskinpackstarwarsclassic

Minecraft incontra Star Wars, ed è un evento storico: il famoso gioco a cubetti lancia infatti oggi un esclusivo DLC con i personaggi della saga fantascientifica firmata George Lucas. Il pacchetto non sarà per tutti però, sarà disponibile in esclusiva per gli utenti Xbox One e Xbox 360, come annunciato dalla stessa Microsoft sul suo blog ufficiale.

Nello Star Wars Pack troveremo ben 55 skins con i personaggi di Star Wars dall’episodio IV all’episodio VI, inoltre ad un prezzo davvero vantaggioso, 2.99$, all’incirca 2 euro. Ma non è tutto, Microsoft promette altre skins aggiuntive molto presto. Ma andiamo a scoprire nel dettaglio tutti i personaggi inclusi in questa espansione:

Luke Skywalker, Tatooine
Luke Skywalker, X-wing Pilot
Luke Skywalker, Bespin
Luke Skywalker, Hoth
Luke Skywalker, Dagobah
Luke Skywalker, Endor
Luke Skywalker, Jedi Knight
Han Solo, Smuggler
Han Solo, Hoth
Han Solo, Endor
Chewbacca
Princess Leia Organa, Senator
Princess Leia Organa, Yavin 4
Princess Leia Organa, Hoth
Princess Leia Organa, Bespin
Princess Leia, Jabba’s Palace
Princess Leia Organa, Endor
Tusken Raider
Stormtrooper
Darth Vader
Blockade Runner Soldier
C-3PO
Ben Kenobi
Cantina Band Member
TIE Fighter Pilot
Walrus Man (Ponda Baba)
Hammerhead (Momaw Nadon)
Greedo
Governor Tarkin
Lando Calrissian, Bespin
Boba Fett
Bossk
Dengar
Zuckuss
IG-88
Emperor
AT-AT Pilot
Lobot
Rancor Keeper
Gamorrean Guard
Lando Calrissian, Skiff Guard
Princess Leia Organa, Boushh
Oola
Nien Nunb
Bib Fortuna
Scout Trooper
Emperor’s Royal Guard
Admiral Ackbar
R2-D2
Yoda
Jawa
Wampa Ice Creature
Wicket W. Warrick
Rancor
4-LOM

GTA V: Rockstar Games vi regala una Ps4 e una Xbox One a tema

0

2744609-gtav_xboxps4

Rockstar Games ha appena lanciato un concorso molto interessante che mette in palio una PlayStation 4 e una Xbox One a tema GTA V. Queste console in edizione assolutamente limitata celebrano ovviamente l’uscita del gioco sulla nuova generazione.

Le particolarità che saltano subito agli occhi sono una grande V di GTA V incisa sul lato superiore, alcuni bordi di colore verde e un controller con gli stessi colori. Ulteriori dettagli si possono trovare sulla pagina del concorso ufficiale.

Oltre alle console, che rappresentano il primo premio, anche tanti altri piccoli premi minori tutti a tema. Oggetti merchandising che potranno essere acquistati sullo store ufficiale a breve.

FIFA 15: nuovo aggiornamento disponibile oggi, tutte le novità

0

FIFA15

Electronics Arts ha iniziato a diffondere oggi un nuovo aggiornamento di FIFA 15 Xbox One, PlayStation 4 e PC con tantissime novità e migliorie. Nuovi giocatori e uniformi, punti di ripresa e tweaks che miglioreranno la stabilità generale.

EA ha ovviamente pubblicato il change log ufficiale con tutte le caratteristiche dell’aggiornamento, potete leggere la lista generale in basso, incluse le novità per le versioni Xbox 360 e Ps3.

Contenuto aggiunto e funzioni

• New authentic player faces for promoted Barclays Premier League teams Leicester City, Burnley, and Queens Park Rangers. List of players can be found here
* Accessible after this week’s MatchDay Live update for all non-FUT modes
** Accessible after a FUT squad update coming this week
• Added players, kits, and badges for the two new MLS expansion teams Orlando City and New York City FC to FIFA Ultimate Team
• Updated FIFA Ultimate Team player item portraits for 18 high-profile players
• Added ability to assign Player Instructions via the squad screen in FIFA Ultimate Team

Novità generali

• Gameplay improvements to defensive positioning and lob through balls
• Improvements to kit clashing logic in Pro Clubs and Seasons
• Improvements to cameras in multiple licensed stadiums
• Improvements to “Looking Ahead” audio and overlays in Career Mode
• Improvements in Team Management functionality in multiplayer matches
• General stability fixes in Career Mode
• Ability to Player Lock in Player Career with multiple controllers in use
• Fix to online user population counts in Pro Clubs and Seasons menus
• Fix for issues with player names on certain kits in the BPL
• Fix for audio storylines in in Match Day Live games
• Fixed an issue where transferring progress across console generations could cause FUT Season progress to be tracked incorrectly.
• Addressed FUT player item portraits that show a white background in FUT
• Fixed an issue that would cause the Team of the Week preview to be displayed incorrectly.
• Compare Price in the FUT Transfer Market now works for players who were transferred close to the transfer deadline.
• Using the “Compare Price” feature on in-form Players Items now compares the item with other in-form versions instead of the normal version.

Xbox 360/PS3:

Contenuto aggiunto e funzioni

• New authentic player faces for promoted Barclays Premier League teams Leicester City, Burnley, and Queens Park Rangers.
* Accessible after this week’s MatchDay Live update for all non-FUT modes
** Accessible after a FUT squad update coming this week
• Added players, kits, and badges for the two new MLS expansion teams Orlando City and New York City FC to FIFA Ultimate Team
• Updated FIFA Ultimate Team player item portraits for 18 high-profile players

Novità generali

• Gameplay improvements to defensive positioning and lob through balls
• Improvements to kit clashing logic in Pro Clubs and Seasons
• Stability improvements to Career Mode and Co-op Seasons
• Improvements to cameras in multiple licensed stadiums
• Game Face stability fixes in Career Mode
• Fixed an issue where transferring progress across console generations could cause FUT Seasons progress to be tracked incorrectly.
• Compare Price in the FUT Transfer Market now works for players who were transferred close to the transfer deadline.
• Using the “Compare Price” feature on in-form Players Items now compares the item with other in-form versions instead of the normal version.
• Stability improvements when receiving invites for FUT Friendly Seasons.
• Stability improvements at the end of FUT Single Player Seasons matches
• Fixed undefined text on EASFC notifications for FUT Single Player Season promotions.
• Fixed an issue that would cause the Team of the Week preview to be displayed incorrectly.
• Improved stability when receiving FUT Online Friendlies invites.

Dark Souls II Scholar of the First Sin: Data d’uscita e trailer ufficiale

0

Lo Studio Giapponese di sviluppo FromSoftware ha annunciato oggi che il loro nuovo titolo di punta Dark Souls II Scholar of the First Sin arriverà per le console di tutto il mondo ad aprile prossimo. Dunque il videogames sarà disponibile per quella data per Xbox One e PlayStation 4 insieme a tutte le espansioni “Crown of the Sunken King,” “Crown of the Old Iron King,” e “Crown of the Ivory King”.

Dark Souls II Scholar of the First Sin-2Dark Souls II è un videogioco di ruolo/azione fantasy sviluppato da From Software e pubblicato da Namco Bandai Games. È stato presentato allo Spike Video Game Awards 2012 nel quale venne rivelato che avrebbe avuto una storia differente dal predecessore, una nuova ambientazione e un nuovo protagonista. Il gioco è stato pubblicato per PlayStation 3 e Xbox 360 a marzo 2014, mentre su Microsoft Windows il 25 aprile 2014 in tutto il mondo ad eccezione del Regno Unito, in cui è stato pubblicato il 2 maggio 2014.

Una nuova versione del gioco, intitolata Dark Souls II: Scholar of the First Sin, è in sviluppo oltre che per le piattaforme precedenti, anche per PlayStation 4 e Xbox One. Questa versione includerà tutti e tre i DLC usciti precedentemente, nuovi eventi di gioco che ampliano la storia, nuovi personaggi non giocabili e nemici, miglioramenti nel gameplay, miglioramenti grafici per PlayStation 4, Xbox One e PC. L’uscita è prevista per aprile 2015.

Dopo un filmato introduttivo che mostra il senso di perdita e disperazione che la maledizione dei non morti ha portato nel mondo degli umani, il protagonista viene apparentemente trascinato in un altro mondo chiamato Drangleic, dove incontra in una piccola casa tre delle ultime quattro guardiane del fuoco. Queste si prendono gioco di lui, assicurandogli che diventerà presto, come tutti gli altri venuti prima di lui, vuoto, ovvero privo di ragione. Andando avanti egli giunge a Majula, un tranquillo villaggio dove l’Araldo dello Smeraldo, gli chiede subito se è lui il prossimo monarca. La donna lo indirizza più avanti nel suo viaggio, alla ricerca dei “quattro dotati di immense anime” e del re Vendrick. Recuperate quattro delle anime più potenti in Drangleic, il protagonista viaggia oltre il Castello di Drangleic per raggiungere la Cripta del Non Morto, dove trova un re Vendrick vuoto che gira intorno a una grande stanza. In fondo alla stanza egli trova l’anello del re, che gli permette di raggiungere il Santuario del Drago, dove ottiene dall’Antico Drago una speciale polvere che gli permetterà di viaggiare nelle memorie dei Giganti. Sconfitto il Signore dei Giganti in una delle memorie, il guerriero ritorna al Castello di Drangleic per sconfiggere Nashandra. Dopo averla sconfitta, il protagonista raggiunge la stanza del trono divenendo quindi il nuovo monarca.

Quantum Break: star di X-Men e Lost sul set del gioco Xbox One

0

Remedy Entertainment ha annunciato che le star di X-Men Shawn Ashmore e di Lost e Il Signore degli Anelli Dominic Monaghan appariranno nel videogioco Quantum Break. I due attori sono stati fotografati con le tute mo-cap, utili a catturare i movimenti che saranno utilizzati nel gioco. Non è ovviamente il primo caso in cui un attore ‘invade’ lo spazio videoludico, recentemente ricordiamo l’apparizione di Kevin Spacey in Call of Duty: Advanced Warfare, oppure la coppia Ellen Page e Willem Dafoe in Beyond: Due Anime, titoli in cui gli attori prestano i loro tratti fisici, movimenti e voce.

Quantum Break arriverà nel 2015 in esclusiva per Xbox One e promette di essere un grande live-action show. Seguiremo gli eventi della vita di Jack Joyce intento a fermare gli oscuri piani di una corporazione chiamata Monarch Solutions. Uno scontro epico che permetterà agli sviluppatori di creare interessanti snodi d’azione.

QB